PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK17499.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family TALE
Protein Properties Length: 129aa    MW: 15416.5 Da    PI: 9.695
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK17499.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.42.8e-0954901955
               HHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
   Homeobox 19 FeknrypsaeereeLAkklgLterqVkvWFqNrRake 55
                +k +yps++++  LA+++gL+ +q+ +WF N+R ++
  PK17499.1 54 HYKWPYPSEAQKLGLAESTGLDLKQINNWFINQRKRH 90
               55679*****************************985 PP

2ELK41.72.3e-141031122
        ELK  1 ELKhqLlrKYsgyLgsLkqEFs 22
               ELK qLlrKYsgyLg+LkqEF+
  PK17499.1 10 ELKVQLLRKYSGYLGGLKQEFL 31
               9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF037895.8E-101031IPR005539ELK domain
SMARTSM011881.1E-61031IPR005539ELK domain
PROSITE profilePS5121310.9821030IPR005539ELK domain
PROSITE profilePS5007111.8073093IPR001356Homeobox domain
SMARTSM003893.0E-103297IPR001356Homeobox domain
SuperFamilySSF466894.71E-2032107IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.8E-283595IPR009057Homeodomain-like
CDDcd000863.78E-114294No hitNo description
PfamPF059201.3E-175089IPR008422Homeobox KN domain
PROSITE patternPS0002706891IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 129 aa     Download sequence    Send to blast
LIDPQAEDKE LKVQLLRKYS GYLGGLKQEF LKKKKNGKLP KEARQQLLEW WSRHYKWPYP  60
SEAQKLGLAE STGLDLKQIN NWFINQRKRH WKPSEDMQFV VMDAAHPAHY YMDNIIYNPF  120
SMDTIFDPX
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001302988.14e-73homeobox protein SHOOT MERISTEMLESS
RefseqXP_010089440.14e-73Homeobox protein
SwissprotQ388742e-68STM_ARATH; Homeobox protein SHOOT MERISTEMLESS
TrEMBLD3IWE91e-73D3IWE9_PRUPE; Class I KNOX homeobox transcription factor STM-like 2
STRINGVIT_10s0116g00190.t016e-67(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.12e-62KNOX/ELK homeobox transcription factor